PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 512aa    MW: 57150.6 Da    PI: 9.4534
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607324.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-1369125148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av ++ g++Wk+I +++            Rt  qc +rwqk+l
   XP_013607324.1  69 KGGWTPQEDETLRQAVDKYKGKRWKKIGKKLLflsdsteffPERTQVQCLHRWQKVL 125
                      688**************************************99***********986 PP

2Myb_DNA-binding605.2e-19131177148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd ++v++vk++G+  W++Ia+ ++ gR +kqc++rw+++l
   XP_013607324.1 131 KGTWTQEEDAIIVELVKKYGPAKWSLIAKSLP-GRIGKQCRERWHNHL 177
                      799*****************************.*************97 PP

3Myb_DNA-binding58.12.1e-18183226146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WTteE+  l++a +++G++ W+ Ia+ ++ gRt++ +k++w++
   XP_013607324.1 183 KDAWTTEEETALINAQQKHGNK-WAEIAKVLP-GRTDNAIKNHWNS 226
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.26464125IPR017930Myb domain
SMARTSM007171.9E-1168127IPR001005SANT/Myb domain
PfamPF002491.3E-1169125IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-1370135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1971141IPR009057Homeodomain-like
CDDcd001672.44E-972125No hitNo description
PROSITE profilePS5129431.981126181IPR017930Myb domain
SuperFamilySSF466899.73E-32128224IPR009057Homeodomain-like
SMARTSM007175.4E-18130179IPR001005SANT/Myb domain
PfamPF002491.2E-17131177IPR001005SANT/Myb domain
CDDcd001672.68E-15133177No hitNo description
Gene3DG3DSA:1.10.10.601.0E-26142185IPR009057Homeodomain-like
SMARTSM007176.4E-17182230IPR001005SANT/Myb domain
PROSITE profilePS5129422.444182232IPR017930Myb domain
PfamPF002493.8E-16183226IPR001005SANT/Myb domain
CDDcd001676.43E-13185228No hitNo description
Gene3DG3DSA:1.10.10.603.9E-23186232IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MKSSGSNPLA FSPAKERSEM KIEILCMENK QPTPASASEG SVNIFLYSPQ LKTPAPAHRR  60
TSGPMRRAKG GWTPQEDETL RQAVDKYKGK RWKKIGKKLL FLSDSTEFFP ERTQVQCLHR  120
WQKVLNPELI KGTWTQEEDA IIVELVKKYG PAKWSLIAKS LPGRIGKQCR ERWHNHLNPG  180
IRKDAWTTEE ETALINAQQK HGNKWAEIAK VLPGRTDNAI KNHWNSSLKK KLDFYFATCN  240
LPPSATKLSS ATKPLKDSDS VTQSSSVNID ANEDGVDHVD SSSDMLEESG VNEYACSPVS  300
VECKPQLPNL RPMSPRINSN AFVQKKEENG FGTPRHGNLY YKSPLDSYFA SEADLRRMYG  360
YECGCSPSAV SSSPVSLTIT PPCNKDSGLA AATRSPESFL REAARTFPNT PSIFRKRRKV  420
VLAKKTDDVV NSAVKEADQN ENSKDSAVIS PVGREALLLL ETVDDSNEVL SFNVSPPYRV  480
IAKRRAVFKS RQLEFTSAKE NQPETSEEDK SV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-62682325159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-62682325159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607324.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0D3EIC60.0A0A0D3EIC6_BRAOL; Uncharacterized protein
STRINGBra009597.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.20.0myb domain protein 3r-5